PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01545.20
Common NameJCGZ_27045, LOC105647074
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 317aa    MW: 35000.9 Da    PI: 7.4028
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01545.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.42.9e-32205258255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Jcr4S01545.20 205 PRMRWTSSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 258
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.54E-15202259IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-29203259IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-24205258IPR006447Myb domain, plants
PfamPF002494.0E-7206257IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MSHKGGILDK QSLNQIPDLS LQISLPNSAP SSICTGTNDV DDSIFDLKSH SDSSIKVGFQ  60
AQDSTVLSLA NTNNIALEAE SAWRRTSFPG SGCREREASI DIRPTNGQIN DGISVSAGFK  120
AIKGIPVYNS YGDIADPRFF YNPMSYSSSC TPYPGDNCSF PAYRVTPEYH HNHHQYGGAE  180
VYGNGIIRSR FMPKLQNNKR NMRAPRMRWT SSLHARFVHA VELLGGHERA TPKSVLELMD  240
VKDLTLAHVK SHLQMYRTVK STDKPAASSD GSADEDNFLS VTTPISQNAN HLLNNKELST  300
FSPEHENAYS WCSNSTR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088451.10.0PREDICTED: transcription repressor KAN1-like isoform X2
TrEMBLA0A067JJF10.0A0A067JJF1_JATCU; Uncharacterized protein
STRINGPOPTR_0012s03900.11e-116(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.14e-50G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]